• Gene id: 392636

Gene Summary

• Gene Symbol: AGMO   Gene   UCSC   Ensembl
• Aliases: TMEM195
• Gene name: alkylglycerol monooxygenase
• Alternate names: alkylglycerol monooxygenase, glyceryl-ether monooxygenase, transmembrane protein 195,
• Gene location: 7p21.2 (5200699: 5199734)     Exons: 1     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a tetrahydrobiopterin- and iron-dependent enzyme that cleaves the ether bond of alkylglycerols. Sequence comparisons distinguish this protein as forming a third, distinct class of tetrahydrobiopterin-dependent enzymes.
• OMIM: 613738

Protein Summary

• Protein general information: Q6ZNB7  
  • Name: Alkylglycerol monooxygenase (EC 1.14.16.5) (Transmembrane protein 195)
  • Length: 445  
  • Mass: 51500
• Sequence:

  MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTS
  ISAGVLSRLPSLFFRSIELTSYIYIWENYRLFNLPWDSPWTWYSAFLGVDFGYYWFHRMAHEVNIMWAGHQTHHS
  SEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQFNLLYQFWIHTEVINNLGPLELILNTPSHHRVHH
  GRNRYCIDKNYAGVLIIWDKIFGTFEAENEKVVYGLTHPINTFEPIKVQFHHLFSIWTTFWATPGFFNKFSVIFK
  GPGWGPGKPRLGLSEEIPEVTGKEVPFSSSSSQLLKIYTVVQFALMLAFYEETFADTAALSQVTLLLRVCFIILT
  LTSIGFLLDQRPKAAIMETLRCLMFLMLYRFGHLKPLVPSLSSAFEIVFSICIAFWGVRSMKQLTSHPWK

• Structural information:
  • Protein Domains: (120..24-)
    hydroxylase (/note="Fatty-acid)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR006694  
  • STRING: ENSP00000341662
• Other Databases: GeneCards:  AGMO  Malacards:  AGMO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006643	membrane lipid metabolic process	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0050479	glyceryl-ether monooxygenase activity	IBA	molecular function
GO:0050479	glyceryl-ether monooxygenase activity	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0046485	ether lipid metabolic process	IDA	biological process
GO:0006643	membrane lipid metabolic process	IDA	biological process
GO:0005506	iron ion binding	IMP	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0008610	lipid biosynthetic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050479	glyceryl-ether monooxygenase activity	IEA	molecular function
GO:0019432	triglyceride biosynthetic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0050479	glyceryl-ether monooxygenase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq