|
Gene id |
391356 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
PTRHD1 Gene UCSC Ensembl |
|
Aliases |
C2orf79 |
|
Gene name |
peptidyl-tRNA hydrolase domain containing 1 |
|
Alternate names |
putative peptidyl-tRNA hydrolase PTRHD1, peptidyl-tRNA hydrolase domain-containing protein 1, |
|
Gene location |
2p23.3 (24793381: 24790266) Exons: 2 NC_000002.12
|
|
Gene summary(Entrez) |
This gene encodes the enzyme peptidyl-tRNA hydrolase. Peptidyl-tRNA hydrolases perform the essential function of recycling peptidyl-tRNAs. Mutations in this gene are associated with autosomal-recessive intellectual disability and parkinsonism. [provided b
|
|
OMIM |
617342 |
Protein Summary
|
| Protein general information
| Q6GMV3
Name: Putative peptidyl tRNA hydrolase PTRHD1 (EC 3.1.1.29) (Peptidyl tRNA hydrolase domain containing protein 1)
Length: 140 Mass: 15805
|
| Sequence |
MHRGVGPAFRVVRKMAASGAEPQVLVQYLVLRKDLSQAPFSWPAGALVAQACHAATAALHTHRDHPHTAAYLQEL GRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK
|
| Structural information |
|
| Other Databases |
GeneCards: PTRHD1  Malacards: PTRHD1 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0004045 |
aminoacyl-tRNA hydrolase activity
|
IEA |
molecular function |
GO:0016787 |
hydrolase activity
|
IEA |
molecular function |
GO:0004045 |
aminoacyl-tRNA hydrolase activity
|
IEA |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|