• Gene id: 390667

Gene Summary

• Gene Symbol: PTX4   Gene   UCSC   Ensembl
• Aliases: C16orf38
• Gene name: pentraxin 4
• Alternate names: pentraxin-4, long pentraxin 4, neuronal pentraxin-like protein C16orf38, pentraxin 4, long,
• Gene location: 16p13.3 (1488943: 1485885)     Exons: 4     NC_000016.10
• Gene summary(Entrez): This gene belongs to the pentraxin superfamily, whose members encode highly conserved multifunctional proteins. The encoded protein, like other members of this family, contains a conserved pentraxin domain at the C-terminus. The highest levels of expressi
• OMIM: 610490

Protein Summary

• Protein general information: Q96A99  
  • Name: Pentraxin 4
  • Length: 478  
  • Mass: 52339
  • Tissue specificity: Widely expressed at low levels with highest levels in small intestine, testis and brain. Very low expression in endothelial cells, monocytes, neutrophils and lymphocytes. Isoform 1 is not expressed in small intestine. {ECO
• Sequence:

  MGCSWRKTLSFFLVFVPIYLHGASSQEAAPVGPRKPFFERLRRLEEQFRRFQEVTWTHLQNIASNYNVSYNVDVR
  FRSLAEESQAVAQAVNRSQASVQGELAQLKAWVRKLQRRGRKVDTRLRALDLTLGERSQQRARERKAHKAQRDAL
  QDSLARLEGLVHSQGARLAALEGRLPVAHPGTAALGPALVPTPTQPEELGPTSLKLQRDRQELRAASEHRGPPQD
  SSAPLQGRREPPASGSHRVLSGTAPKDPRQQAWSPQVPGEICGVGPTLVFPNASTRNVVFLSPGFVTALRALSFC
  SWVRTASGRLGTLLSYATEDNDNKLVLHGRDSLLPGSIHFVIGDPAFRELPLQLLLDGQWHHICVIWTSTQGRYW
  LHVDRRLVATGSRFREGYEIPPGGSLVLGQEQDSVGGGFDSSEAFVGSMSGLAIWDRALVPGEVANLAIGKEFPT
  GAILTLANAALAGGFVQGANCTCLERCP

• Structural information:
  • Protein Domains: (269..47-)
    (/note="Pentraxin-(PTX))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01172"-)
  • Interpro: IPR013320  IPR001759  
  • Prosite: PS51828
  • CDD: cd00152
  • STRING: ENSP00000293922
• Other Databases: GeneCards:  PTX4  Malacards:  PTX4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq