Search Result
| Gene id | 390664 | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||
| Gene Symbol | C1QTNF8 Gene UCSC Ensembl | ||||||||||||||||||||||||||||
| Aliases | CTRP8, UNQ5829 | ||||||||||||||||||||||||||||
| Gene name | C1q and TNF related 8 | ||||||||||||||||||||||||||||
| Alternate names | complement C1q tumor necrosis factor-related protein 8, C1q and tumor necrosis factor related protein 8, C1q/TNF-related protein 8, | ||||||||||||||||||||||||||||
| Gene location |
16p13.3 (1096305: 1088225) Exons: 5 NC_000016.10 |
||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||
| Protein general information | P60827 Name: Complement C1q tumor necrosis factor related protein 8 (C1q/TNF related protein 8) (CTRP8) Length: 252 Mass: 27685 Tissue specificity: Expressed predominantly in lung and testis (PubMed | ||||||||||||||||||||||||||||
| Sequence |
MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVRPTIDIEILKGEKGEA GVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFD LAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRD RDNAIYGEHGDLYITFSGHLVKPAAEL | ||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||
| Other Databases | GeneCards: C1QTNF8  Malacards: C1QTNF8 | ||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||