• Gene id: 389799

Gene Summary

• Gene Symbol: CFAP77   Gene   UCSC   Ensembl
• Aliases: C9orf171
• Gene name: cilia and flagella associated protein 77
• Alternate names: cilia- and flagella-associated protein 77,
• Gene location: 9q34.13 (132410042: 132573318)     Exons: 1     NC_000009.12

Protein Summary

• Protein general information: Q6ZQR2  
  • Name: Cilia and flagella associated protein 77
  • Length: 320  
  • Mass: 36499
• Sequence:

  MPEARSSGPDLTRWRKQQQPVRRTVSQVCPPPRRPLTVADIRSGMENERLGVVRDSMFQNPLIVKAAGPASVGTS
  YSVYDSSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPH
  ELTRNYIAMNRGAVKAGLVTARENLLYRQLNDIRISDQDDRRMKKEPPPLPPNMTFGIRARPSTPFFDLLQHRYL
  QLWVQEQKATQKAIKLEKKQKVVLGKLYETRSSQLRKYKPPVKLDTLWHMPHFQKVGRHLDTFPTEADRQRALKA
  HREECAVRQGTLRMGNYTHP

• Structural information:
  • Interpro: IPR029147  
  • STRING: ENSP00000343290
• Other Databases: GeneCards:  CFAP77  Malacards:  CFAP77

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042995	cell projection	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005929	cilium	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Non obstructive azoospermia	MIK: 24012201

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray