• Gene id: 389136

Gene Summary

• Gene Symbol: VGLL3   Gene   UCSC   Ensembl
• Aliases: VGL-3, VGL3
• Gene name: vestigial like family member 3
• Alternate names: transcription cofactor vestigial-like protein 3, colon carcinoma related protein,
• Gene location: 3p12.1 (144333068: 143944413)     Exons: 38     NC_000002.12
• OMIM: 609980

Protein Summary

• Protein general information: A8MV65  
  • Name: Transcription cofactor vestigial like protein 3 (Vgl 3)
  • Length: 326  
  • Mass: 36009
  • Tissue specificity: Enriched in placenta. {ECO
• Sequence:

  MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEK
  DQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSF
  WTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDV
  YMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHG
  TVDIVPSVGFDTGLQHQDKSKESPWY

• Structural information:
  • Interpro: IPR006627  IPR011520  
  • STRING: ENSP00000381436
• Other Databases: GeneCards:  VGLL3  Malacards:  VGLL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	contributes to
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq