• Gene id: 388730

Gene Summary

• Gene Symbol: TMEM81   Gene   UCSC   Ensembl
• Aliases: HC3107, KVLA2788, UNQ2788
• Gene name: transmembrane protein 81
• Alternate names: transmembrane protein 81,
• Gene location: 1q32.1 (205084459: 205083128)     Exons: 1     NC_000001.11

Protein Summary

• Protein general information: Q6P7N7  
  • Name: Transmembrane protein 81
  • Length: 255  
  • Mass: 28468
• Sequence:

  MKVLATSFVLGSLGLAFYLPLVVTTPKTLAIPEKLQEAVGKVIINATTCTVTCGLGYKEETVCEVGPDGVRRKCQ
  TRRLECLTNWICGMLHFTILIGKEFELSCLSSDILEFGQEAFRFTWRLARGVISTDDEVFKPFQANSHFVKFKYA
  QEYDSGTYRCDVQLVKNLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWKKKVA
  SALGIGIAIGVVGGVLVRIVLCALRGGLQQ

• Structural information:
  • Protein Domains: (83..17-)
    (/note="Ig-like"-)
  • Interpro: IPR007110  IPR036179  IPR039293  
  • Prosite: PS50835
  • STRING: ENSP00000356135
• Other Databases: GeneCards:  TMEM81  Malacards:  TMEM81

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray