• Gene id: 388695

Gene Summary

• Gene Symbol: LYSMD1   Gene   UCSC   Ensembl
• Aliases: SB145
• Gene name: LysM domain containing 1
• Alternate names: lysM and putative peptidoglycan-binding domain-containing protein 1, LysM, putative peptidoglycan-binding, domain containing 1, RP11-68I18.5,
• Gene location: 1q21.3 (151165901: 151148495)     Exons: 7     NC_000001.11
• OMIM: 611130

Protein Summary

• Protein general information: Q96S90  
  • Name: LysM and putative peptidoglycan binding domain containing protein 1
  • Length: 227  
  • Mass: 25003
• Sequence:

  MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDS
  IFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQETPTPIH
  DLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIF
  KL

• Structural information:
  • Protein Domains: (40..8-)
    (/note="LysM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01118"-)
  • Interpro: IPR018392  IPR036779  
  • Prosite: PS51782
  • CDD: cd00118
  • PDB: 2DJP
  • PDBsum: 2DJP
  • STRING: ENSP00000357904
• Other Databases: GeneCards:  LYSMD1  Malacards:  LYSMD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R