• Gene id: 388650

Gene Summary

• Gene Symbol: DIPK1A   Gene   UCSC   Ensembl
• Aliases: FAM69A
• Gene name: divergent protein kinase domain 1A
• Alternate names: divergent protein kinase domain 1A, family with sequence similarity 69 member A, protein FAM69A,
• Gene location: 1p22.1 (92961521: 92832728)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the FAM69 family of cysteine-rich type II transmembrane proteins. These proteins localize to the endoplasmic reticulum but their specific functions are unknown. Alternatively spliced transcript variants encoding multiple isof
• OMIM: 614542

Protein Summary

• Protein general information: Q5T7M9  
  • Name: Divergent protein kinase domain 1A (Protein FAM69A)
  • Length: 428  
  • Mass: 49024
• Sequence:

  MARSLCPGAWLRKPYYLQARFSYVRMKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCKKIICDKYKTGVIDGP
  ACNSLCVTETLYFGKCLSTKPNNQMYLGIWDNLPGVVKCQMEQALHLDFGTELEPRKEIVLFDKPTRGTTVQKFK
  EMVYSLFKAKLGDQGNLSELVNLILTVADGDKDGQVSLGEAKSAWALLQLNEFLLMVILQDKEHTPKLMGFCGDL
  YVMESVEYTSLYGISLPWVIELFIPSGFRRSMDQLFTPSWPRKAKIAIGLLEFVEDVFHGPYGNFLMCDTSAKNL
  GYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDQSTMKCTSEVIQPNLAKACQLLKDYLL
  RGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNLKTLLWKKISYTNDS

• Structural information:
  • Interpro: IPR022049  IPR029244  
  • STRING: ENSP00000359333
• Other Databases: GeneCards:  DIPK1A  Malacards:  DIPK1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)