Search Result
| Gene id | 388551 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | CEACAM16 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CEAL2, DFNA4B, DFNB113 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | CEA cell adhesion molecule 16, tectorial membrane component | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | carcinoembryonic antigen-related cell adhesion molecule 16, carcinoembryonic antigen like-2 protein, carcinoembryonic antigen related cell adhesion molecule 16, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
19q13.31-q13.32 (44699150: 44710717) Exons: 7 NC_000019.10 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a secreted glycoprotein that in mouse interacts with tectorial membrane proteins in the inner ear. The encoded adhesion protein is found in cochlear outer hair cells and appears to be important for proper hearing over a |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q2WEN9 Name: Carcinoembryonic antigen related cell adhesion molecule 16 (Carcinoembryonic antigen like 2) Length: 425 Mass: 45873 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MALTGYSWLLLSATFLNVGAEISITLEPAQPSEGDNVTLVVHGLSGELLAYSWYAGPTLSVSYLVASYIVSTGDE TPGPAHTGREAVRPDGSLDIQGILPRHSGTYILQTFNRQLQTEVGYGHVQVHEILAQPTVLANSTALVERRDTLR LMCSSPSPTAEVRWFFNGGALPVALRLGLSPDGRVLARHGIRREEAGAYQCEVWNPVSVSRSEPINLTVYFGPER VAILQDSTTRTGCTIKVDFNTSLTLWCVSRSCPEPEYVWTFNGQALKNGQDHLNISSMTAAQEGTYTCIAKNTKT LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPA HTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQVAPLG | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CEACAM16  Malacards: CEACAM16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||