Search Result
| Gene id | 388531 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | RGS9BP Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | PERRS, R9AP, RGS9 | ||||||||||||||||||||||||||||||||||||
| Gene name | regulator of G protein signaling 9 binding protein | ||||||||||||||||||||||||||||||||||||
| Alternate names | regulator of G-protein signaling 9-binding protein, RGS9 anchor protein, RGS9-anchoring protein, | ||||||||||||||||||||||||||||||||||||
| Gene location |
19q13.11 (32675847: 32678299) Exons: 1 NC_000019.10 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene functions as a regulator of G protein-coupled receptor signaling in phototransduction. Studies in bovine and mouse show that this gene is expressed only in the retina, and is localized in the rod outer segment membranes. T |
||||||||||||||||||||||||||||||||||||
| OMIM | 614591 | ||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | Q6ZS82 Name: Regulator of G protein signaling 9 binding protein (RGS9 anchoring protein) Length: 235 Mass: 25148 | ||||||||||||||||||||||||||||||||||||
| Sequence |
MAREECKALLDGLNKTTACYHHLVLTVGGSADSQNLRQELQKTRQKAQELAVSTCARLTAVLRDRGLAADERAEF ERLWVAFSGCLDLLEADMRRALELGAAFPLHAPRRPLVRTGVAGASSGVAARALSTRSLRLEAEGDFDVADLREL EREVLQVGEMIDNMEMKVNVPRWTVQARQAAGAELLSTVSAGPSSVVSLQERGGGCDPRKALAAILFGAVLLAAV ALAVCVAKLS | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: RGS9BP  Malacards: RGS9BP | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||