• Gene id: 388403

Gene Summary

• Gene Symbol: YPEL2   Gene   UCSC   Ensembl
• Aliases: FKSG4
• Gene name: yippee like 2
• Alternate names: protein yippee-like 2, DiGeorge syndrome-related protein,
• Gene location: 17q22 (59331654: 59401731)     Exons: 5     NC_000017.11
• OMIM: 609723

Protein Summary

• Protein general information: Q96QA6  
  • Name: Protein yippee like 2
  • Length: 119  
  • Mass: 13577
  • Tissue specificity: Widely expressed. Detected in fetal and adult kidney, heart, liver, lung and skeletal muscle. {ECO
• Sequence:

  MVKMTRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVA
  DIYCENCKTTLGWKYEHAFESSQKYKEGKYIIELAHMIKDNGWD

• Structural information:
  • Protein Domains: (19..11-)
    (/note="Yippee-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01128"-)
  • Interpro: IPR034751  IPR004910  IPR039058  
  • Prosite: PS51792
  • STRING: ENSP00000312272
• Other Databases: GeneCards:  YPEL2  Malacards:  YPEL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)