• Gene id: 388364

Gene Summary

• Gene Symbol: TMIGD1   Gene   UCSC   Ensembl
• Aliases: TMIGD, UNQ9372
• Gene name: transmembrane and immunoglobulin domain containing 1
• Alternate names: transmembrane and immunoglobulin domain-containing protein 1, AWKS9372,
• Gene location: 17q11.2 (102062123: 102012839)     Exons: 8     NC_000012.12

Protein Summary

• Protein general information: Q6UXZ0  
  • Name: Transmembrane and immunoglobulin domain containing protein 1
  • Length: 262  
  • Mass: 29185
• Sequence:

  MAWKSSVIMQMGRFLLLVILFLPREMTSSVLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVD
  LKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQ
  AQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVPIEPII
  AACVVIFLTLCFGLIARRKKIMKLCMKDKDPHSETAL

• Structural information:
  • Protein Domains: (30..11-)
    1 (/note="Ig-like-C2-type)
    (122..20-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  
  • Prosite: PS50835
  • STRING: ENSP00000332404
• Other Databases: GeneCards:  TMIGD1  Malacards:  TMIGD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043005	neuron projection	IBA	cellular component
GO:0030334	regulation of cell migration	IDA	biological process
GO:0042127	regulation of cell population proliferation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0090559	regulation of membrane permeability	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)