|
Gene id |
387882 |
| Gene Summary Protein Summary Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
C12orf75 Gene UCSC Ensembl |
|
Aliases |
AGD3, OCC-1, OCC1 |
|
Gene name |
chromosome 12 open reading frame 75 |
|
Alternate names |
overexpressed in colon carcinoma 1 protein, adipogenesis down-regulated 3, overexpressed in colon carcinoma-1, putative overexpressed in colon carcinoma-1 protein variant C, |
|
Gene location |
12q23.3 (105330690: 105371517) Exons: 6 NC_000012.12
|
|
OMIM |
0 |
Protein Summary
|
| Protein general information
| Q8TAD7
Name: Overexpressed in colon carcinoma 1 protein (OCC 1) (AGD3)
Length: 63 Mass: 6407
Tissue specificity: High expression in placenta, skeletal muscle, kidney and pancreas tissues. Absent or very faint expression in heart, brain, lung and liver. Expressed during adipogenic differentiation of mesenchymal stem cells (at protein level). {ECO
|
| Sequence |
MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN
|
| Structural information |
|
| Other Databases |
GeneCards: C12orf75  Malacards: C12orf75 |
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|