• Gene id: 387357

Gene Summary

• Gene Symbol: THEMIS   Gene   UCSC   Ensembl
• Aliases: C6orf190, C6orf207, GASP, SPOT, TSEPA
• Gene name: thymocyte selection associated
• Alternate names: protein THEMIS, GRB2-associated protein, signaling phosphoprotein specific for T cells, thymocyte selection pathway associated, thymocyte-expressed molecule involved in selection,
• Gene location: 6q22.33 (127918630: 127708193)     Exons: 12     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein that plays a regulatory role in both positive and negative T-cell selection during late thymocyte development. The protein functions through T-cell antigen receptor signaling, and is necessary for proper lineage commitment and

Protein Summary

• Protein general information: Q8N1K5  
  • Name: Protein THEMIS (Thymocyte expressed molecule involved in selection)
  • Length: 641  
  • Mass: 73452
• Sequence:

  MALSLEEFVHSLDLRTLPRVLEIQAGIYLEGSIYEMFGNECCFSTGEVIKITGLKVKKIIAEICEQIEGCESLQP
  FELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNSVEEIDGEIMV
  SCAVARNHQTHSFNLPLSQEGEFYECEDERIYTLKEIVEWKIPKNRTRTVNLTDFSNKWDSTNPFPKDFYGTLIL
  KPVYEIQGVMKFRKDIIRILPSLDVEVKDITDSYDANWFLQLLSTEDLFEMTSKEFPIVTEVIEAPEGNHLPQSI
  LQPGKTIVIHKKYQASRILASEIRSNFPKRHFLIPTSYKGKFKRRPREFPTAYDLEIAKSEKEPLHVVATKAFHS
  PHDKLSSVSVGDQFLVHQSETTEVLCEGIKKVVNVLACEKILKKSYEAALLPLYMEGGFVEVIHDKKQYPISELC
  KQFRLPFNVKVSVRDLSIEEDVLAATPGLQLEEDITDSYLLISDFANPTECWEIPVGRLNMTVQLVSNFSRDAEP
  FLVRTLVEEITEEQYYMMRRYESSASHPPPRPPKHPSVEETKLTLLTLAEERTVDLPKSPKRHHVDITKKLHPNQ
  AGLDSKVLIGSQNDLVDEEKERSNRGATAIAETFKNEKHQK

• Structural information:
  • Interpro: IPR025946  IPR039671  
  • STRING: ENSP00000357231
• Other Databases: GeneCards:  THEMIS  Malacards:  THEMIS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0043383	negative T cell selection	ISS	biological process
GO:0050852	T cell receptor signaling pathway	ISS	biological process
GO:0043368	positive T cell selection	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005911	cell-cell junction	IEA	cellular component
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0043383	negative T cell selection	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043368	positive T cell selection	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008180	COP9 signalosome	ISS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq