Search Result
| Gene id | 387263 | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||
| Gene Symbol | C6orf120 Gene UCSC Ensembl | ||||||||||||||||||||||||||||
| Gene name | chromosome 6 open reading frame 120 | ||||||||||||||||||||||||||||
| Alternate names | UPF0669 protein C6orf120, | ||||||||||||||||||||||||||||
| Gene location |
6q27 (169702111: 169706359) Exons: 1 NC_000006.12 |
||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a conserved, N-glycosylated protein that likely functions in the cellular response to endoplasmic reticulum stress. This protein is able to induce apoptosis in vitro in CD4+ T-cells. Alternative splicing results in multiple transcript va |
||||||||||||||||||||||||||||
| OMIM | 616987 | ||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||
| Protein general information | Q7Z4R8 Name: UPF0669 protein C6orf120 Length: 191 Mass: 20772 Tissue specificity: Mainly expressed in hepatocytes and some weak expression in germinal center cells of lymph nodes. {ECO | ||||||||||||||||||||||||||||
| Sequence |
MAAPRGRAAPWTTALLLLLASQVLSPGSCADEEEVPEEWVLLHVVQGQIGAGNYSYLRLNHEGKIVLRMRSLKGD ADLYVSASSLHPSFDDYELQSATCGPDAVSIPAHFRRPVGIGVYGHPSHLESEFEMKVYYDGTVEQHPFGEAAYP ADGADAGQKHAGAPEDASQEEESVLWTILISILKLVLEILF | ||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||
| Other Databases | GeneCards: C6orf120  Malacards: C6orf120 | ||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||