• Gene id: 386724

Gene Summary

• Gene Symbol: AMIGO3   Gene   UCSC   Ensembl
• Aliases: ALI3, AMIGO-3
• Gene name: adhesion molecule with Ig like domain 3
• Alternate names: amphoterin-induced protein 3, alivin-3, amphoterin-induced gene and ORF 3,
• Gene location: 3p21.31 (49719683: 49716828)     Exons: 1     NC_000003.12
• OMIM: 615691

Protein Summary

• Protein general information: Q86WK7  
  • Name: Amphoterin induced protein 3 (AMIGO 3) (Alivin 3)
  • Length: 504  
  • Mass: 55250
• Sequence:

  MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGLGLQDVPAELPAATADLDLSHNALQR
  LRPGWLAPLFQLRALHLDHNELDALGRGVFVNASGLRLLDLSSNTLRALGRHDLDGLGALEKLLLFNNRLVHLDE
  HAFHGLRALSHLYLGCNELASFSFDHLHGLSATHLLTLDLSSNRLGHISVPELAALPAFLKNGLYLHNNPLPCDC
  RLYHLLQRWHQRGLSAVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPALGLERPEEHLYALVGRSLRLYC
  NTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQEQHAGLFVCLATGPRLHHNQTHEYNVSVHFPR
  PEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCRCCRRACRCRRWPQTPSPLQELSAQSSVLSTTPPDAPSRKASV
  HKHVVFLEPGRRGLNGRVQLAVAEEFDLYNPGGLQLKAGSESASSIGSEGPMTT

• Structural information:
  • Protein Domains: (25..6-)
    (/note="LRRNT-)
    (219..27-)
    (/note="LRRCT-)
    (277..37-)
    (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR031283  IPR031285  IPR007110  IPR036179  IPR013783   IPR003599  IPR003598  IPR001611  IPR003591  IPR032675  
  • Prosite: PS50835 PS51450
  • STRING: ENSP00000323096
• Other Databases: GeneCards:  AMIGO3  Malacards:  AMIGO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007420	brain development	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq