Search Result
| Gene id | 386682 | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||
| Gene Symbol | KRTAP10-3 Gene UCSC Ensembl | ||||||||||||||||||||
| Aliases | KAP10.3, KAP18-3, KAP18.3, KRTAP10.3, KRTAP18-3, KRTAP18.3 | ||||||||||||||||||||
| Gene name | keratin associated protein 10-3 | ||||||||||||||||||||
| Alternate names | keratin-associated protein 10-3, high sulfur keratin-associated protein 10.3, keratin-associated protein 18-3, keratin-associated protein 18.3, | ||||||||||||||||||||
| Gene location |
21q22.3 (44558794: 44557789) Exons: 1 NC_000021.9 |
||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- |
||||||||||||||||||||
| OMIM | 607234 | ||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||
| Protein general information | P60369 Name: Keratin associated protein 10 3 (High sulfur keratin associated protein 10.3) (Keratin associated protein 10.3) (Keratin associated protein 18 3) (Keratin associated protein 18.3) Length: 221 Mass: 22348 Tissue specificity: Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues. {ECO | ||||||||||||||||||||
| Sequence |
MATSTMSVCSSAYSDSWQVDACPESCCEPPCCATSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSPCQSGCTSSC TPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCKPVCCKPICCVPVCSGASSSCCQQSSRQPACCTTS CCRPSSSVSLLCRPVCRSTCCVPIPSCCAPASTCQPSCCRPASCVSLLCRPTCSRLSSACCGLSSGQKSSC | ||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||
| Other Databases | GeneCards: KRTAP10-3  Malacards: KRTAP10-3 | ||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||
| |||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||
| |||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||
| |||||||||||||||||||||