• Gene id: 386617

Gene Summary

• Gene Symbol: KCTD8   Gene   UCSC   Ensembl
• Gene name: potassium channel tetramerization domain containing 8
• Alternate names: BTB/POZ domain-containing protein KCTD8, potassium channel tetramerisation domain containing 8,
• Gene location: 4p13 (44449791: 44173902)     Exons: 3     NC_000004.12
• OMIM: 609826

Protein Summary

• Protein general information: Q6ZWB6  
  • Name: BTB/POZ domain containing protein KCTD8
  • Length: 473  
  • Mass: 52440
• Sequence:

  MALKDTGSGGSTILPISEMVSSSSSPGASAAAAPGPCAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTLASMFS
  PSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLTDLVKLLSPKV
  TKQNSLNDEGCQSDLEDNVSQGSSDALLLRGAAAAVPSGPGAHGGGGGGGAQDKRSGFLTLGYRGSYTTVRDNQA
  DAKFRRVARIMVCGRIALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAA
  FVNQYRDDKIWSSYTEYIFFRPPQKIVSPKQEHEDRKHDKVTDKGSESGTSCNELSTSSCDSHSEASTPQDNPSS
  AQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKI
  HIPDYFPERKRQWQSELLQKYGL

• Structural information:
  • Protein Domains: (44..12-)
    (/note="BTB"-)
  • Interpro: IPR000210  IPR011333  IPR003131  
  • PDB: 6G57
  • PDBsum: 6G57
  • STRING: ENSP00000353129
• Other Databases: GeneCards:  KCTD8  Malacards:  KCTD8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043235	receptor complex	IBA	cellular component
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IBA	biological process
GO:0051260	protein homooligomerization	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0043235	receptor complex	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881