• Gene id: 3823

Gene Summary

• Gene Symbol: KLRC3   Gene   UCSC   Ensembl
• Aliases: NKG2-E, NKG2E
• Gene name: killer cell lectin like receptor C3
• Alternate names: NKG2-E type II integral membrane protein, NK cell receptor E, NKG2-E-activating NK receptor, killer cell lectin-like receptor subfamily C, member 3,
• Gene location: 12p13.2 (10420594: 10412314)     Exons: 7     NC_000012.12
• Gene summary(Entrez): Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
• OMIM: 602892

Protein Summary

• Protein general information: Q07444  
  • Name: NKG2 E type II integral membrane protein (NK cell receptor E) (NKG2 E activating NK receptor)
  • Length: 240  
  • Mass: 27100
  • Tissue specificity: Natural killer cells.
• Sequence:

  MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASLNHQGIDKIYDCQGLLPPPEKLTAEV
  LGIICIVLMATVLKTIVLIPFLEQNNSSPNARTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLQACASKNS
  SSLLCIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRI
  IRRGFIMLTRLVLNS

• Structural information:
  • Protein Domains: (116..23-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR016187  IPR033992  
  • Prosite: PS50041
  • CDD: cd03593
  • STRING: ENSP00000437563
• Other Databases: GeneCards:  KLRC3  Malacards:  KLRC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0006968	cellular defense response	TAS	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04650	Natural killer cell mediated cytotoxicity
hsa04612	Antigen processing and presentation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)