• Gene id: 3812

Gene Summary

• Gene Symbol: KIR3DL2   Gene   UCSC   Ensembl
• Aliases: 3DL2, CD158K, KIR-3DL2, NKAT-4, NKAT4, NKAT4B, p140
• Gene name: killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
• Alternate names: killer cell immunoglobulin-like receptor 3DL2, CD158 antigen-like family member K, KIR antigen 3DL2, MHC class I NK cell receptor, killer Ig receptor, killer cell immunoglobulin-like receptor 2DL2, killer cell immunoglobulin-like receptor, three domains, long c,
• Gene location: 19q13.42 (54850319: 54867208)     Exons: 4     NC_000019.10
• Gene summary(Entrez): Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
• OMIM: 604947

Protein Summary

• Protein general information: P43630  
  • Name: Killer cell immunoglobulin like receptor 3DL2 (CD158 antigen like family member K) (MHC class I NK cell receptor) (Natural killer associated transcript 4) (NKAT 4) (p70 natural killer cell receptor clone CL 5) (p70 NK receptor CL 5) (CD antigen CD158k)
  • Length: 455  
  • Mass: 50230
  • Tissue specificity: Expressed in astrocytes. {ECO
• Sequence:

  MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRI
  FQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMF
  EHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPS
  LSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRAL
  PCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQ
  EPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSG
  LEGVF

• Structural information:
  • Protein Domains: (42..10-)
    1 (/note="Ig-like-C2-type)
    (137..20-)
    2 (/note="Ig-like-C2-type)
    (237..30-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR036179  IPR013783  IPR003599  IPR013151  
  • STRING: ENSP00000325525
• Other Databases: GeneCards:  KIR3DL2  Malacards:  KIR3DL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0023029	MHC class Ib protein binding	IDA	molecular function
GO:1901215	negative regulation of neuron death	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006968	cellular defense response	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04650	Natural killer cell mediated cytotoxicity
hsa04612	Antigen processing and presentation
hsa05332	Graft-versus-host disease

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881