• Gene id: 378925

Gene Summary

• Gene Symbol: RNF148   Gene   UCSC   Ensembl
• Gene name: ring finger protein 148
• Alternate names: RING finger protein 148,
• Gene location: 7q31.32 (122702921: 122701667)     Exons: 1     NC_000007.14
• OMIM: 610310

Protein Summary

• Protein general information: Q8N7C7  
  • Name: RING finger protein 148
  • Length: 305  
  • Mass: 34397
  • Tissue specificity: Abundantly expressed in testis and slightly in pancreas. Mainly present in the interstitial cells of testicular tissues. {ECO
• Sequence:

  MSFLRITPSTHSSVSSGLLRLSIFLLLSFPDSNGKAIWTAHLNITFQVGNEITSELGESGVFGNHSPLERVSGVV
  ALPEGWNQNACHPLTNFSRPKQADSWLALIERGGCTFTHKINVAAEKGANGVIIYNYQGTGSKVFPMSHQGTENI
  VAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRR
  SQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKPQDVVRILTCKHFFHKACIDPWLLAHRTCPMCKC
  DILKT

• Structural information:
  • Protein Domains: (65..16-)
    (/note="PA"-)
  • Interpro: IPR003137  IPR001841  IPR013083  
  • Prosite: PS50089
  • STRING: ENSP00000388207
• Other Databases: GeneCards:  RNF148  Malacards:  RNF148

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005770	late endosome	IBA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray