• Gene id: 3780

Gene Summary

• Gene Symbol: KCNN1   Gene   UCSC   Ensembl
• Aliases: KCa2.1, SK1, SKCA1, hSK1
• Gene name: potassium calcium-activated channel subfamily N member 1
• Alternate names: small conductance calcium-activated potassium channel protein 1, potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 1, potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1, small,
• Gene location: 19p13.11 (10116859: 10074338)     Exons: 15     NC_000004.12
• Gene summary(Entrez): Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is
• OMIM: 602982

Protein Summary

• Protein general information: Q92952  
  • Name: Small conductance calcium activated potassium channel protein 1 (SK1) (SKCa 1) (SKCa1) (KCa2.1)
  • Length: 543  
  • Mass: 59987
• Sequence:

  MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPRGQPQDQDDDEDDEED
  EAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYTKESLYSFALKCLISLST
  AILLGLVVLYHAREIQLFMVDNGADDWRIAMTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEAD
  VDVLLSIPMFLRLYLLGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
  VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAE
  KHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARVRKHQRKFLQAIHQAQKLRSVKIEQGKLNDQ
  ANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQ
  AARSSPCRWTPVAPSDCG

• Structural information:
  • Interpro: IPR004178  IPR036122  IPR015449  IPR013099  
  • STRING: ENSP00000476519
• Other Databases: GeneCards:  KCNN1  Malacards:  KCNN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043005	neuron projection	IBA	cellular component
GO:0016286	small conductance calcium-activated potassium channel activity	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0043197	dendritic spine	IBA	cellular component
GO:0043025	neuronal cell body	IBA	cellular component
GO:0006811	ion transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016286	small conductance calcium-activated potassium channel activity	IEA	molecular function
GO:0006813	potassium ion transport	IEA	biological process
GO:0015269	calcium-activated potassium channel activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015269	calcium-activated potassium channel activity	TAS	molecular function
GO:0006813	potassium ion transport	TAS	biological process
GO:0008076	voltage-gated potassium channel complex	TAS	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0016286	small conductance calcium-activated potassium channel activity	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04911	Insulin secretion
hsa04929	GnRH secretion

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq