• Gene id: 377

Gene Summary

• Gene Symbol: ARF3   Gene   UCSC   Ensembl
• Gene name: ADP ribosylation factor 3
• Alternate names: ADP-ribosylation factor 3, small GTP binding protein,
• Gene location: 12q13.12 (48957525: 48930251)     Exons: 8     NC_000012.12
• Gene summary(Entrez): ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as act
• OMIM: 103190

SNPs

rs28362491

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000004.12   g.102500998_102501001ATTG[1]
NC_000004.11   g.103422155_103422158ATTG[1]
NG_050628.1   g.4670_4673ATTG[1]|SEQ=[ATTG/-]|GENE=NFKB1
LOC105377621   105377621

rs17262815

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000008.11   g.129478919T>C
NC_000008.10   g.130491165T>C|SEQ=[T/C]|GENE=CCDC26

Protein Summary

• Protein general information: P61204  
  • Name: ADP ribosylation factor 3
  • Length: 181  
  • Mass: 20601
• Sequence:

  MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
  PLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH
  RNWYIQATCATSGDGLYEGLDWLANQLKNKK

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR006689  
  • Prosite: PS51417
  • PDB: 6II6
  • PDBsum: 6II6
  • STRING: ENSP00000256682
• Other Databases: GeneCards:  ARF3  Malacards:  ARF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0005525	GTP binding	TAS	molecular function
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IGI	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881