• Gene id: 3765

Gene Summary

• Gene Symbol: KCNJ9   Gene   UCSC   Ensembl
• Aliases: GIRK3, KIR3.3
• Gene name: potassium inwardly rectifying channel subfamily J member 9
• Alternate names: G protein-activated inward rectifier potassium channel 3, G protein-coupled inward rectifier potassium channel, inward rectifier K(+) channel Kir3.3, inwardly rectifier K+ channel KIR3.3, potassium channel, inwardly rectifying subfamily J member 9, potassium v,
• Gene location: 1q23.2 (160081537: 160090562)     Exons: 3     NC_000001.11
• Gene summary(Entrez): Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, whi
• OMIM: 610410

Protein Summary

• Protein general information: Q92806  
  • Name: G protein activated inward rectifier potassium channel 3 (GIRK 3) (Inward rectifier K(+) channel Kir3.3) (Potassium channel, inwardly rectifying subfamily J member 9)
  • Length: 393  
  • Mass: 44020
• Sequence:

  MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFF
  GAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVN
  AFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQ
  TDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
  GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAG
  ADKEQNGCLPPPESESKV

• Structural information:
  • Interpro: IPR014756  IPR041647  IPR016449  IPR003276  IPR013518   IPR040445  
  • STRING: ENSP00000357067
• Other Databases: GeneCards:  KCNJ9  Malacards:  KCNJ9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0034765	regulation of ion transmembrane transport	IBA	biological process
GO:1990573	potassium ion import across plasma membrane	IBA	biological process
GO:0005242	inward rectifier potassium channel activity	IBA	molecular function
GO:0005242	inward rectifier potassium channel activity	IEA	molecular function
GO:0015467	G-protein activated inward rectifier potassium channel activity	IEA	molecular function
GO:0006813	potassium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0098688	parallel fiber to Purkinje cell synapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04723	Retrograde endocannabinoid signaling
hsa04921	Oxytocin signaling pathway
hsa04728	Dopaminergic synapse
hsa04915	Estrogen signaling pathway
hsa04726	Serotonergic synapse
hsa05032	Morphine addiction
hsa04713	Circadian entrainment
hsa04929	GnRH secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881