• Gene id: 374986

Gene Summary

• Gene Symbol: MIGA1   Gene   UCSC   Ensembl
• Aliases: FAM73A
• Gene name: mitoguardin 1
• Alternate names: mitoguardin 1, family with sequence similarity 73, member A, protein FAM73A,
• Gene location: 1p31.1 (88467707: 88480775)     Exons: 7     NC_000015.10
• OMIM: 616773

Protein Summary

• Protein general information: Q8NAN2  
  • Name: Mitoguardin 1 (Protein FAM73A)
  • Length: 632  
  • Mass: 71006
• Sequence:

  MSDCCSAPGISWEAGVGRPAVPGLELQIRRGAMSEETVSESQFSLKTAALRVFDLPLTWYYSLSQIKFSPVAKKL
  FVVTAVSAISVIFLAHHFKRKRGKKKGKILPWEPEHLILEYTKRAASDKGSSCSSSRQNLTLSLSSTKDKGSQVC
  NYANGGLFSKYSGSAQSLASVQSVNSCHSCACGNSNSWDKADEDDIKLVNIPVTTPENLYLMGMELFEEALRRWE
  QALTFRNRQAEDEACGSIKLGAGDAIAEENVDDIISTEFIHKLEALLQRAYRLQEEFEATLGASDPNSLADDIDK
  DTDITMKGNVEDFGLRDTLSIASTDSFASAAELAEHREVRHTYSLESLCHCPFYEEAMHLVEEGKIYSRVLRTEM
  LECLGDSDFLAKLHCIRQAFQVILSESANRIFLAESGRKILSALIVKARKNPKKFEDVFDEMIYFLEQTDHWGST
  EMELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQNVVNNRWLNSSFKETAVASSCWSVLKQKRQQMKIPDG
  FFAHFYAICEHISPVLAWGFLGPRNSLYDLCCFFKNQVLLFLKDIFDFEKVRYSSTETLAEDLMQLLIRRTELLM
  AYLEADALRHTSSCLSSHGHVMSTGLLEAKVQ

• Structural information:
  • Interpro: IPR019392  
  • STRING: ENSP00000393675
• Other Databases: GeneCards:  MIGA1  Malacards:  MIGA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008053	mitochondrial fusion	IBA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0008053	mitochondrial fusion	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008053	mitochondrial fusion	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq