• Gene id: 374946

Gene Summary

• Gene Symbol: DRAXIN   Gene   UCSC   Ensembl
• Aliases: AGPA3119, C1orf187, UNQ3119, neucrin
• Gene name: dorsal inhibitory axon guidance protein
• Alternate names: draxin, dorsal repulsive axon guidance protein, neural tissue-specific cysteine-rich protein,
• Gene location: 1p36.22 (11686634: 11725856)     Exons: 10     NC_000001.11
• OMIM: 612682

Protein Summary

• Protein general information: Q8NBI3  
  • Name: Draxin (Dorsal inhibitory axon guidance protein) (Dorsal repulsive axon guidance protein) (Neucrin)
  • Length: 349  
  • Mass: 38650
• Sequence:

  MAGPAIHTAPMLFLVLLLPLELSLAGALAPGTPARNLPENHIDLPGPALWTPQASHHRRRGPGKKEWGPGLPSQA
  QDGAVVTATRQASRLPEAEGLLPEQSPAGLLQDKDLLLGLALPYPEKENRPPGWERTRKRSREHKRRRDRLRLHQ
  GRALVRGPSSLMKKAELSEAQVLDAAMEESSTSLAPTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRSDGEVM
  PTLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLREHLCTPHNRGL
  NNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV

• Structural information:
  • Interpro: IPR029094  
  • PDB: 6FKQ
  • PDBsum: 6FKQ
  • STRING: ENSP00000294485
• Other Databases: GeneCards:  DRAXIN  Malacards:  DRAXIN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IBA	cellular component
GO:0021516	dorsal spinal cord development	IBA	biological process
GO:0021528	commissural neuron differentiation in spinal cord	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0030900	forebrain development	IBA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0021528	commissural neuron differentiation in spinal cord	ISS	biological process
GO:0021516	dorsal spinal cord development	ISS	biological process
GO:0005576	extracellular region	ISS	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0030900	forebrain development	ISS	biological process
GO:0007411	axon guidance	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0021528	commissural neuron differentiation in spinal cord	IEA	biological process
GO:0021516	dorsal spinal cord development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0021516	dorsal spinal cord development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0021528	commissural neuron differentiation in spinal cord	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0007411	axon guidance	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray