• Gene id: 374887

Gene Summary

• Gene Symbol: YJEFN3   Gene   UCSC   Ensembl
• Gene name: YjeF N-terminal domain containing 3
• Alternate names: yjeF N-terminal domain-containing protein 3, apolipoprotein A1 binding protein, hYjeF_N3, hYjeF_N3-19p13.11, yjeF_N3,
• Gene location: 19p13.11 (19528900: 19537583)     Exons: 8     NC_000019.10
• OMIM: 618607

Protein Summary

• Protein general information: A6XGL0  
  • Name: YjeF N terminal domain containing protein 3 (YjeF_N3) (hYjeF_N3)
  • Length: 299  
  • Mass: 32585
  • Tissue specificity: Expressed in theca cells in ovary and in Leydig cells in testis (at protein level). Also expressed in brain and mammary gland. {ECO
• Sequence:

  MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQSTAEAA
  ALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHLRVFEYEPTIF
  YPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLV
  SLDIPSGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL

• Structural information:
  • Protein Domains: (74..28-)
    (/note="YjeF-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00719"-)
  • Interpro: IPR004443  IPR036652  IPR032976  
  • Prosite: PS51385
  • STRING: ENSP00000426964
• Other Databases: GeneCards:  YJEFN3  Malacards:  YJEFN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0052856	NADHX epimerase activity	IBA	molecular function
GO:0052857	NADPHX epimerase activity	IBA	molecular function
GO:0071425	hematopoietic stem cell proliferation	ISS	biological process
GO:0016525	negative regulation of angiogenesis	ISS	biological process
GO:0002040	sprouting angiogenesis	ISS	biological process
GO:0008593	regulation of Notch signaling pathway	ISS	biological process
GO:0031580	membrane raft distribution	ISS	biological process
GO:0010874	regulation of cholesterol efflux	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray