• Gene id: 3748

Gene Summary

• Gene Symbol: KCNC3   Gene   UCSC   Ensembl
• Aliases: KSHIIID, KV3.3, SCA13
• Gene name: potassium voltage-gated channel subfamily C member 3
• Alternate names: potassium voltage-gated channel subfamily C member 3, Shaw-related voltage-gated potassium channel protein 3, potassium channel, voltage gated Shaw related subfamily C, member 3, potassium voltage-gated channel, Shaw-related subfamily, member 3, voltage-gated,
• Gene location: 19q13.33 (50333535: 50311936)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encode

Protein Summary

• Protein general information: Q14003  
  • Name: Potassium voltage gated channel subfamily C member 3 (KSHIIID) (Voltage gated potassium channel subunit Kv3.3)
  • Length: 757  
  • Mass: 80578
• Sequence:

  MLSSVCVSSFRGRQGASKQQPAPPPQPPESPPPPPLPPQQQQPAQPGPAASPAGPPAPRGPGDRRAEPCPGLPAA
  AMGRHGGGGGDSGKIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGADEFFFDRHPGVFAYVLNY
  YRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEALDSFEAPDPAGAANAANAAGAHDGGLD
  DEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPPGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFFI
  LISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVWFTFEFLMRITFCPDKVE
  FLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLL
  LIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCAL
  AGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGISPPPPI
  TPPSMGVTVAGAYPAGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIEINRADPRPNGDPAAAALAHE
  DCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNAN
  AAAWISP

• Structural information:
  • Interpro: IPR000210  IPR005821  IPR003968  IPR003974  IPR005404   IPR021105  IPR011333  IPR003131  IPR028325  IPR027359  
  • STRING: ENSP00000434241
• Other Databases: GeneCards:  KCNC3  Malacards:  KCNC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030424	axon	IBA	cellular component
GO:0005251	delayed rectifier potassium channel activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0043025	neuronal cell body	IBA	cellular component
GO:0032809	neuronal cell body membrane	IBA	cellular component
GO:0032590	dendrite membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0051262	protein tetramerization	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0071805	potassium ion transmembrane transport	IMP	biological process
GO:0005249	voltage-gated potassium channel activity	IMP	molecular function
GO:0071805	potassium ion transmembrane transport	IMP	biological process
GO:0005249	voltage-gated potassium channel activity	IMP	molecular function
GO:0071805	potassium ion transmembrane transport	IMP	biological process
GO:0005249	voltage-gated potassium channel activity	IMP	molecular function
GO:0071805	potassium ion transmembrane transport	IMP	biological process
GO:0005249	voltage-gated potassium channel activity	IMP	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0032591	dendritic spine membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05017	Spinocerebellar ataxia

Diseases

Associated diseases	References
Spinocerebellar ataxia	KEGG:H00063
Spinocerebellar ataxia	KEGG:H00063
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray