• Gene id: 374739

Gene Summary

• Gene Symbol: TEPP   Gene   UCSC   Ensembl
• Gene name: testis, prostate and placenta expressed
• Alternate names: testis, prostate and placenta-expressed protein, testicular tissue protein Li 196, testis/prostate/placenta-expressed protein,
• Gene location: 16q21 (57976434: 57988115)     Exons: 11     NC_000016.10
• OMIM: 610264

Protein Summary

• Protein general information: Q6URK8  
  • Name: Testis, prostate and placenta expressed protein
  • Length: 271  
  • Mass: 30717
  • Tissue specificity: Expressed in testis, prostate and placenta. {ECO
• Sequence:

  MGIVCAQCSFILLLSIIRARPPPFLFCPLSSQRTESPYKPVHLGLGPTDKVAAIAMARIIDLVPWDDGSTHVYAS
  PAILLPMERQRNQLAGVKQQLYHPALPTLRHMDRDTVKACLPDEHCQSTTYCRKDEFDNAHFTLLGVPNKPLQCL
  DITATGQKLRNRYHEGKLAPIAPGINRVDWPCFTRAIEDWSHFVSSAGEFKLPCLRKRAEGLSGYAVRYLKPDVT
  QTWRYCLSQNPSLDRYGQKPLPFDSLNTFRSFGSSYSRVNYLTPWH

• Structural information:
  • Interpro: IPR034584  
  • STRING: ENSP00000290871
• Other Databases: GeneCards:  TEPP  Malacards:  TEPP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881