• Gene id: 3707

Gene Summary

• Gene Symbol: ITPKB   Gene   UCSC   Ensembl
• Aliases: IP3-3KB, IP3K, IP3K-B, IP3KB, PIG37
• Gene name: inositol-trisphosphate 3-kinase B
• Alternate names: inositol-trisphosphate 3-kinase B, IP3 3-kinase B, IP3K B, inositol 1,4,5-trisphosphate 3-kinase B, insP 3-kinase B, proliferation-inducing protein 37,
• Gene location: 1q42.12 (226739295: 226631689)     Exons: 10     NC_000001.11
• Gene summary(Entrez): The protein encoded by this protein regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large num
• OMIM: 147522

Protein Summary

• Protein general information: P27987  
  • Name: Inositol trisphosphate 3 kinase B (EC 2.7.1.127) (Inositol 1,4,5 trisphosphate 3 kinase B) (IP3 3 kinase B) (IP3K B) (InsP 3 kinase B)
  • Length: 946  
  • Mass: 102376
• Sequence:

  MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPRRAVLSPGSVFSPGRGASFLFPPAESLSPEEPRSPGGW
  RSGRRRLNSSSGSGSGSSGSSVSSPSWAGRLRGDRQQVVAAGTLSPPGPEEAKRKLRILQRELQNVQVNQKVGMF
  EAHIQAQSSAIQAPRSPRLGRARSPSPCPFRSSSQPPGRVLVQGARSEERRTKSWGEQCPETSGTDSGRKGGPSL
  CSSQVKKGMPPLPGRAAPTGSEAQGPSAFVRMEKGIPASPRCGSPTAMEIDKRGSPTPGTRSCLAPSLGLFGASL
  TMATEVAARVTSTGPHRPQDLALTEPSGRARELEDLQPPEALVERQGQFLGSETSPAPERGGPRDGEPPGKMGKG
  YLPCGMPGSGEPEVGKRPEETTVSVQSAESSDSLSWSRLPRALASVGPEEARSGAPVGGGRWQLSDRVEGGSPTL
  GLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTG
  VQSEGTWESQRQDSDALPSPELLPQDPDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSS
  SSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSPFVMSFKKKYPWIQLAG
  HAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRT
  YLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNR
  DFKKTKTREQVTEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGK
  TTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQDAPLA

• Structural information:
  • Interpro: IPR005522  IPR038286  
  • STRING: ENSP00000411152
• Other Databases: GeneCards:  ITPKB  Malacards:  ITPKB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016301	kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	IBA	molecular function
GO:0032958	inositol phosphate biosynthetic process	IBA	biological process
GO:0051765	inositol tetrakisphosphate kinase activity	IBA	molecular function
GO:0071277	cellular response to calcium ion	IDA	biological process
GO:0032957	inositol trisphosphate metabolic process	IDA	biological process
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0032958	inositol phosphate biosynthetic process	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046638	positive regulation of alpha-beta T cell differentiation	IEA	biological process
GO:0045059	positive thymic T cell selection	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0002262	myeloid cell homeostasis	IEA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IEA	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IEA	biological process
GO:0045061	thymic T cell selection	IEA	biological process
GO:0035726	common myeloid progenitor cell proliferation	IEA	biological process
GO:0033030	negative regulation of neutrophil apoptotic process	IEA	biological process
GO:0030217	T cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04020	Calcium signaling pathway
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq