• Gene id: 3675

Gene Summary

• Gene Symbol: ITGA3   Gene   UCSC   Ensembl
• Aliases: CD49C, FRP-2, GAP-B3, GAPB3, ILNEB, MSK18, VCA-2, VL3A, VLA3a
• Gene name: integrin subunit alpha 3
• Alternate names: integrin alpha-3, CD49 antigen-like family member C, alpha 3 subunit of VLA-3 receptor, antigen CD49C, antigen identified by monoclonal antibody J143, galactoprotein B3, integrin alpha 3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), testi,
• Gene location: 17q21.33 (50056064: 50090480)     Exons: 26     NC_000017.11
• Gene summary(Entrez): The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is pro
• OMIM: 153370

Protein Summary

• Protein general information: P26006  
  • Name: Integrin alpha 3 (CD49 antigen like family member C) (FRP 2) (Galactoprotein B3) (GAPB3) (VLA 3 subunit alpha) (CD antigen CD49c) [Cleaved into: Integrin alpha 3 heavy chain; Integrin alpha 3 light chain]
  • Length: 1051  
  • Mass: 116612
  • Tissue specificity: Isoform 1 is widely expressed. Isoform 2 is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform 1 is strongly expressed on vascular smooth muscle cel
• Sequence:

  MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQTERQQRYLLLAGAP
  RELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWS
  GSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSY
  MIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEG
  SQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLLLHGPSGSAFGLSVAS
  IGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGEKLGLPGLATFGYSLSGQMDVDENFYPDLLV
  GSLSDHIVLLRARPVINIVHKTLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRR
  PPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQA
  QALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALL
  TLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPM
  ILTLLVDYTLQTSLSMVNHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVS
  NGKWLLYPTEITVHGNGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
  VLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSIPTINMENKTTWFS
  VDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRARTRALYEAKRQKAEMKSQPSETERLTDD
  Y

• Structural information:
  • Interpro: IPR013517  IPR013519  IPR000413  IPR013649  IPR018184   IPR028994  IPR032695  
  • Prosite: PS51470 PS00242
  • DIP: 140
  • STRING: ENSP00000007722
• Other Databases: GeneCards:  ITGA3  Malacards:  ITGA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035640	exploration behavior	ISS	biological process
GO:0060076	excitatory synapse	ISS	cellular component
GO:0097060	synaptic membrane	ISS	cellular component
GO:0035024	negative regulation of Rho protein signal transduction	ISS	biological process
GO:0097062	dendritic spine maintenance	ISS	biological process
GO:0097062	dendritic spine maintenance	ISS	biological process
GO:0031527	filopodium membrane	IDA	cellular component
GO:0071438	invadopodium membrane	IDA	cellular component
GO:1903078	positive regulation of protein localization to plasma membrane	IDA	biological process
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0008305	integrin complex	TAS	cellular component
GO:0007160	cell-matrix adhesion	TAS	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0010634	positive regulation of epithelial cell migration	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0007613	memory	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:1990812	growth cone filopodium	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043236	laminin binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0034698	response to gonadotropin	IEA	biological process
GO:0034667	integrin alpha3-beta1 complex	IEA	cellular component
GO:0031345	negative regulation of cell projection organization	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007507	heart development	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005518	collagen binding	IEA	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0001968	fibronectin binding	IEA	molecular function
GO:0097062	dendritic spine maintenance	IEA	biological process
GO:0097060	synaptic membrane	IEA	cellular component
GO:0060076	excitatory synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0035640	exploration behavior	IEA	biological process
GO:0035024	negative regulation of Rho protein signal transduction	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0071438	invadopodium membrane	IEA	cellular component
GO:0031527	filopodium membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0034667	integrin alpha3-beta1 complex	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0048333	mesodermal cell differentiation	IEP	biological process
GO:0030510	regulation of BMP signaling pathway	IMP	biological process
GO:0097205	renal filtration	IMP	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0030111	regulation of Wnt signaling pathway	IMP	biological process
GO:0043588	skin development	IMP	biological process
GO:0030324	lung development	IMP	biological process
GO:0034667	integrin alpha3-beta1 complex	IMP	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0072006	nephron development	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017015	regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04810	Regulation of actin cytoskeleton
hsa04510	Focal adhesion
hsa05414	Dilated cardiomyopathy
hsa04512	ECM-receptor interaction
hsa05410	Hypertrophic cardiomyopathy
hsa05222	Small cell lung cancer
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq