• Gene id: 3663

Gene Summary

• Gene Symbol: IRF5   Gene   UCSC   Ensembl
• Aliases: SLEB10
• Gene name: interferon regulatory factor 5
• Alternate names: interferon regulatory factor 5,
• Gene location: 7q32.1 (128937031: 128950041)     Exons: 14     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune syst
• OMIM: 607218

Protein Summary

• Protein general information: Q13568  
  • Name: Interferon regulatory factor 5 (IRF 5)
  • Length: 498  
  • Mass: 56044
• Sequence:

  MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYT
  EGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEEL
  QRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPA
  SLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP
  SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHF
  LNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDL
  KDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ

• Structural information:
  • Interpro: IPR019817  IPR001346  IPR019471  IPR029838  IPR017855   IPR008984  IPR036388  IPR036390  
  • Prosite: PS00601 PS51507
  • CDD: cd00103
  • PDB: 3DSH
  • PDBsum: 3DSH
  • DIP: 46348
  • STRING: ENSP00000349770
• Other Databases: GeneCards:  IRF5  Malacards:  IRF5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043565	sequence-specific DNA binding	IMP	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0002376	immune system process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0032494	response to peptidoglycan	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0032495	response to muramyl dipeptide	IDA	biological process
GO:0032727	positive regulation of interferon-alpha production	IC	biological process
GO:0032728	positive regulation of interferon-beta production	IC	biological process
GO:0032735	positive regulation of interleukin-12 production	IC	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04620	Toll-like receptor signaling pathway

Diseases

Associated diseases	References
Systemic sclerosis	KEGG:H01492
Inflammatory bowel disease	KEGG:H01227
Sjogren syndrome	KEGG:H01502
Systemic sclerosis	KEGG:H01492
Inflammatory bowel disease	KEGG:H01227
Sjogren syndrome	KEGG:H01502
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)