• Gene id: 3603

Gene Summary

• Gene Symbol: IL16   Gene   UCSC   Ensembl
• Aliases: LCF, NIL16, PRIL16, prIL-16
• Gene name: interleukin 16
• Alternate names: pro-interleukin-16, lymphocyte chemoattractant factor, neuronal interleukin 16, prointerleukin 16,
• Gene location: 15q25.1 (81196878: 81314057)     Exons: 22     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. The signaling process of this cytokine is mediated by CD4. The product of this gene unde
• OMIM: 601297

Protein Summary

• Protein general information: Q14005  
  • Name: Pro interleukin 16 [Cleaved into: Interleukin 16 (IL 16) (Lymphocyte chemoattractant factor) (LCF)]
  • Length: 1332  
  • Mass: 141752
  • Tissue specificity: [Isoform 3]
• Sequence:

  MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSSVQLADTSEAGPSSVP
  DLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEAQSSNFLFPKACHQRARSNSTSVNPYCTREI
  DFPMTKKSAAPTDRQPYSLCSNRKSLSQQLDCPAGKAAGTSRPTRSLSTAQLVQPSGGLQASVISNIVLMKGQAK
  GLGFSIVGGKDSIYGPIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTHQDALQKFKQAKKGLLTLTVR
  TRLTAPPSLCSHLSPPLCRSLSSSTCITKDSSSFALESPSAPISTAKPNYRIMVEVSLQKEAGVGLGIGLCSVPY
  FQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEISDSPVHCLTLNEVYTILSHCDPGPVPIIVSRHPDPQVSEQQL
  KEAVAQAVENTKFGKERHQWSLEGVKRLESSWHGRPTLEKEREKNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSP
  GSGSAEKPSSDVDISTHSPSLPLAREPVVLSIASSRLPQESPPLPESRDSHPPLRLKKSFEILVRKPMSSKPKPP
  PRKYFKSDSDPQKSLEERENSSCSSGHTPPTCGQEARELLPLLLPQEDTAGRSPSASAGCPGPGIGPQTKSSTEG
  EPGWRRASPVTQTSPIKHPLLKRQARMDYSFDTTAEDPWVRISDCIKNLFSPIMSENHGHMPLQPNASLNEEEGT
  QGHPDGTPPKLDTANGTPKVYKSADSSTVKKGPPVAPKPAWFRQSLKGLRNRASDPRGLPDPALSTQPAPASREH
  LGSHIRASSSSSSIRQRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAAPTLVPQQP
  EQVLSSGSPAASEARDPGVSESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMPSQRARSFPLTRSQSC
  ETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLN
  LSELREYTEGLTEAKEDDDGDHSSLQSGQSVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLG
  FSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTRKLTP
  EAMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQS
  ETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

• Structural information:
  • Protein Domains: (216..30-)
    (/note="PDZ-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (355..44-)
    (/note="PDZ-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (1112..119-)
    (/note="PDZ-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (-)
  • Interpro: IPR020450  IPR001478  IPR036034  
  • Prosite: PS50106
  • PDB: 1I16 1X6D 5FB8
  • PDBsum: 1I16 1X6D 5FB8
  • DIP: 6006
  • STRING: ENSP00000302935
• Other Databases: GeneCards:  IL16  Malacards:  IL16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:2001184	positive regulation of interleukin-12 secretion	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0050717	positive regulation of interleukin-1 alpha secretion	IDA	biological process
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0050930	induction of positive chemotaxis	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0042609	CD4 receptor binding	IBA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0050930	induction of positive chemotaxis	IEA	biological process
GO:0030595	leukocyte chemotaxis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042609	CD4 receptor binding	IPI	molecular function
GO:0051924	regulation of calcium ion transport	IDA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:2001184	positive regulation of interleukin-12 secretion	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0050717	positive regulation of interleukin-1 alpha secretion	IDA	biological process
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0050930	induction of positive chemotaxis	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0042609	CD4 receptor binding	IBA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0050930	induction of positive chemotaxis	IEA	biological process
GO:0030595	leukocyte chemotaxis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042609	CD4 receptor binding	IPI	molecular function
GO:0051924	regulation of calcium ion transport	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Allergic contact dermatitis	KEGG:H01357
Allergic contact dermatitis	KEGG:H01357
Prostate cancer	PMID:18264096
Asthma	PMID:16734115
Asthma	PMID:16387589
Astrocytoma	PMID:17221335
Chronic obstructive pulmonary disease	PMID:20079227
Chronic fatigue syndrome	PMID:26615570
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq