• Gene id: 3590

Gene Summary

• Gene Symbol: IL11RA   Gene   UCSC   Ensembl
• Aliases: CRSDA
• Gene name: interleukin 11 receptor subunit alpha
• Alternate names: interleukin-11 receptor subunit alpha, IL-11 receptor subunit alpha, IL-11R subunit alpha, interleukin 11 receptor, alpha, interleukin-11 receptor alpha chain,
• Gene location: 9p13.3 (34652184: 34661901)     Exons: 14     NC_000009.12
• Gene summary(Entrez): Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. This gene encodes the IL-11 receptor, which is a member of the hemat
• OMIM: 615103

Protein Summary

• Protein general information: Q14626  
  • Name: Interleukin 11 receptor subunit alpha (IL 11 receptor subunit alpha) (IL 11R subunit alpha) (IL 11R alpha) (IL 11RA)
  • Length: 422  
  • Mass: 45222
  • Tissue specificity: Expressed in a number of cell lines, including the myelogenous leukemia cell line K-562, the megakaryocytic leukemia cell line M-07e, the erythroleukemia cell line TF-1, and the osteosarcoma cell lines, MG-63 and SaOS-2. Also expressed
• Sequence:

  MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGL
  GHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRK
  KTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLR
  VESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
  AGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRDSVEQVAVLASLGIL
  SFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAPNL

• Structural information:
  • Protein Domains: (27..11-)
    (/note="Ig-like-C2-type)
    (112..21-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (220..31-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR003530  IPR007110  IPR036179   IPR013783  IPR003599  
  • Prosite: PS50853 PS01354 PS50835
  • CDD: cd00063
  • DIP: 3776
  • STRING: ENSP00000450565
• Other Databases: GeneCards:  IL11RA  Malacards:  IL11RA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043235	receptor complex	IBA	cellular component
GO:0019955	cytokine binding	IBA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0004921	interleukin-11 receptor activity	IBA	molecular function
GO:0019970	interleukin-11 binding	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0032502	developmental process	IMP	biological process
GO:0060322	head development	IMP	biological process
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0038154	interleukin-11-mediated signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Craniosynostosis and dental anomalies	KEGG:H02254
Craniosynostosis and dental anomalies	KEGG:H02254
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq