• Gene id: 353324

Gene Summary

• Gene Symbol: SPATA12   Gene   UCSC   Ensembl
• Aliases: SRG5
• Gene name: spermatogenesis associated 12
• Alternate names: spermatogenesis-associated protein 12, spermatogenesis-related protein 5, testicular tissue protein Li 184,
• Gene location: 3p14.3 (57060663: 57075431)     Exons: 4     NC_000003.12
• Gene summary(Entrez): This gene is expressed primarily in testis and may play a role in testicular development and spermatogenesis. The encoded protein may be upregulated in response to ultraviolet-C radiation. [provided by RefSeq, Dec 2015]
• OMIM: 609869

Protein Summary

• Protein general information: Q7Z6I5  
  • Name: Spermatogenesis associated protein 12 (Spermatogenesis related protein 5)
  • Length: 190  
  • Mass: 20418
  • Tissue specificity: Expressed in testis. {ECO
• Sequence:

  MSSSALTCGSTLEKSGDTWEMKALDSSRLVPWPPRGLGSSTQHPNKPHCALASCQGPGVLPGAASALPELTFQGD
  VCQSETCQRYLQAAISLDIAVSQINLLGRPSSPPALLIQQGSCEQVIHNSTPQFLGMEDGDNERTTGWLWRLCED
  IDAEPSSTGCSRSNQLTFTEGCFVRSLSTVYSNTHIHTHL

• Structural information:
  • STRING: ENSP00000335392
• Other Databases: GeneCards:  SPATA12  Malacards:  SPATA12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881