• Gene id: 350

Gene Summary

• Gene Symbol: APOH   Gene   UCSC   Ensembl
• Aliases: B2G1, B2GP1, BG
• Gene name: apolipoprotein H
• Alternate names: beta-2-glycoprotein 1, APC inhibitor, B2GPI, activated protein C-binding protein, anticardiolipin cofactor, apo-H, apolipoprotein H (beta-2-glycoprotein I), beta(2)GPI, epididymis secretory sperm binding protein,
• Gene location: 17q24.2 (66229414: 66212032)     Exons: 8     NC_000017.11
• Gene summary(Entrez): Apolipoprotein H, also known as beta-2-glycoprotein I, is a component of circulating plasma lipoproteins. It has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, hemostasis, and the production of antiphos
• OMIM: 615694

Protein Summary

• Protein general information: P02749  
  • Name: Beta 2 glycoprotein 1 (APC inhibitor) (Activated protein C binding protein) (Anticardiolipin cofactor) (Apolipoprotein H) (Apo H) (Beta 2 glycoprotein I) (B2GPI) (Beta(2)GPI)
  • Length: 345  
  • Mass: 38298
  • Tissue specificity: Expressed by the liver and secreted in plasma.
• Sequence:

  MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPIN
  TLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTF
  ATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLY
  YKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFC
  KNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

• Structural information:
  • Protein Domains: (21..8-)
    (/note="Sushi-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (82..13-)
    (/note="Sushi-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (140..20-)
    (/note="Sushi-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (-)
  • Interpro: IPR035976  IPR015104  IPR000436  
  • Prosite: PS50923
  • CDD: cd00033
  • PDB: 1C1Z 1G4F 1G4G 1QUB 2KRI 3OP8 4JHS
  • PDBsum: 1C1Z 1G4F 1G4G 1QUB 2KRI 3OP8 4JHS
  • DIP: 46878
  • STRING: ENSP00000205948
• Other Databases: GeneCards:  APOH  Malacards:  APOH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0030193	regulation of blood coagulation	IEA	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0060230	lipoprotein lipase activator activity	IDA	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001937	negative regulation of endothelial cell proliferation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0010596	negative regulation of endothelial cell migration	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0031639	plasminogen activation	IDA	biological process
GO:0033033	negative regulation of myeloid cell apoptotic process	IDA	biological process
GO:0034392	negative regulation of smooth muscle cell apoptotic process	IDA	biological process
GO:0042627	chylomicron	IDA	cellular component
GO:0051918	negative regulation of fibrinolysis	IDA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0034197	triglyceride transport	ISS	biological process
GO:0006641	triglyceride metabolic process	IDA	biological process
GO:0007597	blood coagulation, intrinsic pathway	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0030195	negative regulation of blood coagulation	IDA	biological process
GO:0034361	very-low-density lipoprotein particle	IDA	cellular component
GO:0034364	high-density lipoprotein particle	IDA	cellular component
GO:0051006	positive regulation of lipoprotein lipase activity	IDA	biological process
GO:0051917	regulation of fibrinolysis	IDA	biological process
GO:0030194	positive regulation of blood coagulation	TAS	biological process
GO:0005576	extracellular region	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04979	Cholesterol metabolism

Diseases

Associated diseases	References
Arteriosclerosis	PMID:6613192
Antiphospholipid syndrome	PMID:24642748
Peripheral vascular disease	PMID:17626983
macular retinal edema	PMID:16080911
Myocardial infarction	PMID:15322656
Diabetic retinopathy	PMID:18695102
diabetes mellitus	PMID:18695102
diabetes mellitus	PMID:9377806
type 2 diabetes mellitus	PMID:16126948
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray