• Gene id: 349334

Gene Summary

• Gene Symbol: FOXD4L4   Gene   UCSC   Ensembl
• Aliases: FOXD4L2, FOXD4b, bA460E7.2
• Gene name: forkhead box D4 like 4
• Alternate names: forkhead box protein D4-like 4, FOXD4-like 4, forkhead box D4-like 2, forkhead box protein D4-like 2, forkhead box protein D4b, myeloid factor-gamma, winged helix factor-1, winged helix transcription factor beta,
• Gene location: 9q21.11 (65737145: 65738395)     Exons: 1     NC_000009.12

Protein Summary

• Protein general information: Q8WXT5  
  • Name: Forkhead box protein D4 like 4 (FOXD4 like 4) (Forkhead box protein D4 like 2) (Forkhead box protein D4B) (Myeloid factor gamma)
  • Length: 416  
  • Mass: 45892
• Sequence:

  MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEARQQFLEQSLQPGLQVARWGGVALPREHIE
  GGGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPPYSYIALITMAILQNPHKRLTLSGICAFISGRFPYYRRKFP
  AWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAH
  AALHNPHPGPLLGAPAPPQPVPGAYPNTAPGRRPYALLHPHPLRYLLLSARVYAGAPKKAEGADLATPAPFPCCS
  PHLVLSLGRRARVWRRHREADASLSALRVLCKGSGERVQGLRRVCPRPRGATATCSSDHQACCIPKPLPLCCKCP
  PPLLLGQFCSNSSSIRRTAPTAALPPRARCWAGTCRPRRRC

• Structural information:
  • Interpro: IPR001766  IPR018122  IPR030456  IPR036388  IPR036390  
  • Prosite: PS00657 PS00658 PS50039
  • CDD: cd00059
  • STRING: ENSP00000366630
• Other Databases: GeneCards:  FOXD4L4  Malacards:  FOXD4L4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0009653	anatomical structure morphogenesis	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881