• Gene id: 3487

Gene Summary

• Gene Symbol: IGFBP4   Gene   UCSC   Ensembl
• Aliases: BP-4, HT29-IGFBP, IBP4, IGFBP-4
• Gene name: insulin like growth factor binding protein 4
• Alternate names: insulin-like growth factor-binding protein 4, IBP-4, IGF-binding protein 4,
• Gene location: 17q21.2 (40443449: 40457724)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the p
• OMIM: 146733

Protein Summary

• Protein general information: P22692  
  • Name: Insulin like growth factor binding protein 4 (IBP 4) (IGF binding protein 4) (IGFBP 4)
  • Length: 258  
  • Mass: 27934
• Sequence:

  MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCG
  SGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKHFAKIRDRS
  TSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGK
  CWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE

• Structural information:
  • Protein Domains: (23..10-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (171..24-)
    (/note="Thyroglobulin-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00500"-)
  • Interpro: IPR009030  IPR022327  IPR000867  IPR009168  IPR022321   IPR017891  IPR000716  IPR036857  
  • Prosite: PS00222 PS51323 PS00484 PS51162
  • CDD: cd00191
  • PDB: 1WQJ 2DSP 2DSQ 2DSR
  • PDBsum: 1WQJ 2DSP 2DSQ 2DSR
  • DIP: 48432
  • STRING: ENSP00000269593
• Other Databases: GeneCards:  IGFBP4  Malacards:  IGFBP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0031994	insulin-like growth factor I binding	IBA	molecular function
GO:0031995	insulin-like growth factor II binding	IBA	molecular function
GO:0043567	regulation of insulin-like growth factor receptor signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0019838	growth factor binding	IEA	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0044342	type B pancreatic cell proliferation	IEA	biological process
GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0010906	regulation of glucose metabolic process	IEA	biological process
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0001558	regulation of cell growth	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq