• Gene id: 348013

Gene Summary

• Gene Symbol: TMEM255B   Gene   UCSC   Ensembl
• Aliases: FAM70B
• Gene name: transmembrane protein 255B
• Alternate names: transmembrane protein 255B, family with sequence similarity 70, member B, protein FAM70B,
• Gene location: 13q34 (113759216: 113816994)     Exons: 13     NC_000013.11
• OMIM: 147045

Protein Summary

• Protein general information: Q8WV15  
  • Name: Transmembrane protein 255B (Protein FAM70B)
  • Length: 326  
  • Mass: 34609
• Sequence:

  MQPPVPGPLGLLDPAEGLSRRKKTSLWFVGSLLLVSVLIVTVGLAATTRTENVTVGGYYPGIILGFGSFLGIIGI
  NLVENRRQMLVAAIVFISFGVVAAFCCAIVDGVFAAQHIEPRPLTTGRCQFYSSGVGYLYDVYQTEVTCHSLDGK
  CQLKVRSNTCYCCDLYACGSAEPSPAYYEFIGVSGCQDVLHLYRLLWASAVLNVLGLFLGIITAAVLGAFKDMVP
  LSQLAYGPAVPPQTLYNPAQQILAYAGFRLTPEPVPTCSSYPLPLQPCSRFPVAPSSALASSEDLQPPSPSSSGS
  GLPGQAPPCYAPTYFPPGEKPPPYAP

• Structural information:
  • Interpro: IPR028014  
  • STRING: ENSP00000364502
• Other Databases: GeneCards:  TMEM255B  Malacards:  TMEM255B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq