• Gene id: 3475

Gene Summary

• Gene Symbol: IFRD1   Gene   UCSC   Ensembl
• Aliases: PC4, TIS7
• Gene name: interferon related developmental regulator 1
• Alternate names: interferon-related developmental regulator 1, 12-O-tetradecanoylphorbol-13-acetate-induced sequence 7, TPA induced sequence 7, nerve growth factor-inducible protein PC4, pheochromocytoma cell-4,
• Gene location: 7q31.1 (112423143: 112477202)     Exons: 15     NC_000007.14
• Gene summary(Entrez): This gene is an immediate early gene that encodes a protein related to interferon-gamma. This protein may function as a transcriptional co-activator/repressor that controls the growth and differentiation of specific cell types during embryonic development
• OMIM: 604897

Protein Summary

• Protein general information: O00458  
  • Name: Interferon related developmental regulator 1 (Nerve growth factor inducible protein PC4)
  • Length: 451  
  • Mass: 50269
  • Tissue specificity: Expressed in a variety of tissues.
• Sequence:

  MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEG
  TQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSDEQRAAAALAS
  VLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYSTLECLENIFTKSYLK
  EKDTTVICSTPNTVLHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDVNMRIAAGESLALLFELARGI
  ESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERDFPTETIKFGPERMYIDCWVKKHTYD
  TFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRFERHLYNSAAFKARTKARSKCRDKRADVGEF
  F

• Structural information:
  • Interpro: IPR016024  IPR039777  IPR006921  IPR007701  
  • STRING: ENSP00000384477
• Other Databases: GeneCards:  IFRD1  Malacards:  IFRD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007518	myoblast fate determination	TAS	biological process
GO:0048671	negative regulation of collateral sprouting	IEA	biological process
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0014706	striated muscle tissue development	IEA	biological process
GO:0042692	muscle cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881