• Gene id: 347411

Gene Summary

• Gene Symbol: MPC1L   Gene   UCSC   Ensembl
• Aliases: SLC54A3
• Gene name: mitochondrial pyruvate carrier 1 like
• Alternate names: mitochondrial pyruvate carrier 1-like protein, brain protein 44-like protein 2,
• Gene location: Xp11.4 (139708278: 139581767)     Exons: 33     NC_000023.11

Protein Summary

• Protein general information: P0DKB6  
  • Name: Mitochondrial pyruvate carrier 1 like protein
  • Length: 136  
  • Mass: 15138
• Sequence:

  MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTALILYSAIFMRFAYRV
  QPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS

• Structural information:
  • Interpro: IPR005336  
• Other Databases: GeneCards:  MPC1L  Malacards:  MPC1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006850	mitochondrial pyruvate transmembrane transport	IBA	biological process
GO:0031305	integral component of mitochondrial inner membrane	IBA	cellular component
GO:0050833	pyruvate transmembrane transporter activity	IBA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006850	mitochondrial pyruvate transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)