• Gene id: 346653

Gene Summary

• Gene Symbol: FAM71F2   Gene   UCSC   Ensembl
• Aliases: FAM137B
• Gene name: family with sequence similarity 71 member F2
• Alternate names: protein FAM71F2, family with sequence similarity 137, member B,
• Gene location: 7q32.1 (128671627: 128702261)     Exons: 8     NC_000007.14

Protein Summary

• Protein general information: Q6NXP2  
  • Name: Protein FAM71F2 (Protein FAM137B)
  • Length: 309  
  • Mass: 34516
• Sequence:

  MSKIRGLPPEVREPGPGVELGVENGLLCQLIHSPEFNLFSNSVVFESNFIQTHVPEADFQVTKPGNWRDVCEGSA
  TVILGVTSSVPSLPLPNVLLMANVTWPQGPFTTWSTPGDAPVINLSRLLPLKYVELRIYDRLQRILRVRTVTEKI
  YYLKLHEKHPEIVFQFWVRLVKILQKGLSITTKDPRIKFTHCLVPKMPTNSTETTPENSLLSSPQPSEPLVLLAA
  EQTSGSFSQLSGKPQLTADRNNDTAIEIDNCSSYKIPSPVASPINLNIPMRAALSHSLWEQEDWNEHLLQVHIAS
  YLGEHFLGA

• Structural information:
  • Interpro: IPR022168  
  • STRING: ENSP00000420140
• Other Databases: GeneCards:  FAM71F2  Malacards:  FAM71F2

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)