• Gene id: 344018

Gene Summary

• Gene Symbol: FIGLA   Gene   UCSC   Ensembl
• Aliases: BHLHC8, FIGALPHA, POF6
• Gene name: folliculogenesis specific bHLH transcription factor
• Alternate names: factor in the germline alpha, class C basic helix-loop-helix protein 8, folliculogenesis-specific basic helix-loop-helix protein, transcription factor FIGa,
• Gene location: 2p13.3 (70790642: 70777309)     Exons: 5     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that functions in postnatal oocyte-specific gene expression. The protein is a basic helix-loop-helix transcription factor that regulates multiple oocyte-specific genes, including genes involved in folliculogenesis and those tha
• OMIM: 608789

Protein Summary

• Protein general information: Q6QHK4  
  • Name: Factor in the germline alpha (FIGalpha) (Class C basic helix loop helix protein 8) (bHLHc8) (Folliculogenesis specific basic helix loop helix protein) (Transcription factor FIGa)
  • Length: 219  
  • Mass: 24123
  • Tissue specificity: Germ cells. Expressed in the fetal ovary, but not by a range of other tissues. Expression increases across mid-gestation, rising some 40-fold by the time of primordial follicle formation. {ECO
• Sequence:

  MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENLQLVLERRRVANAKER
  ERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDLLEGAKDSKKQDPDEQSYSNNSSESHTSSAR
  QLSRNITQHISCAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPTRSLDRFPEVELLSHRLPQV

• Structural information:
  • Protein Domains: (65..11-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR036638  
  • Prosite: PS50888
  • CDD: cd00083
  • STRING: ENSP00000333097
• Other Databases: GeneCards:  FIGLA  Malacards:  FIGLA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0048477	oogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0043565	sequence-specific DNA binding	IDA	contributes to
GO:0048599	oocyte development	NAS	biological process
GO:0008134	transcription factor binding	IPI	molecular function

Diseases

Associated diseases	References
Premature ovarian failure	KEGG:H00627
Premature ovarian failure	KEGG:H00627
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq