• Gene id: 3430

Gene Summary

• Gene Symbol: IFI35   Gene   UCSC   Ensembl
• Aliases: IFP35
• Gene name: interferon induced protein 35
• Alternate names: interferon-induced 35 kDa protein, IFP 35, ifi-35,
• Gene location: 17q21.31 (43006783: 43014458)     Exons: 8     NC_000017.11
• OMIM: 600735

Protein Summary

• Protein general information: P80217  
  • Name: Interferon induced 35 kDa protein (IFP 35) (Ifi 35)
  • Length: 286  
  • Mass: 31546
  • Tissue specificity: In a wide range of cell types, including fibroblasts, macrophages, and epithelial cells.
• Sequence:

  MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCP
  LLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEE
  LLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIR
  SQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG

• Structural information:
  • Interpro: IPR034460  IPR009909  IPR009938  IPR012677  
  • STRING: ENSP00000395590
• Other Databases: GeneCards:  IFI35  Malacards:  IFI35

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)