Search Result
| Gene id | 342510 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | CD300E Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CD300LE, CLM-2, CLM2, CMRF35-A5, IREM-2, IREM2, PIgR-2, PIgR2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | CD300e molecule | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | CMRF35-like molecule 2, CD300 antigen-like family member E, CD300e antigen, immune receptor expressed on myeloid cells 2, poly-Ig receptor 2, polymeric immunoglobulin receptor 2, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
17q25.1 (74623957: 74609884) Exons: 5 NC_000017.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of the CD300 glycoprotein family of cell surface proteins expressed on myeloid cells. The protein interacts with the TYRO protein tyrosine kinase-binding protein and is thought to act as an activating receptor. [provided by RefS |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 608697 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q496F6 Name: CMRF35 like molecule 2 (CLM 2) (CD300 antigen like family member E) (CMRF35 A5) (Immune receptor expressed on myeloid cells 2) (IREM 2) (Polymeric immunoglobulin receptor 2) (PIgR 2) (PIgR2) (Poly Ig receptor 2) (CD antigen CD300e) Length: 205 Mass: 22918 Tissue specificity: Present on the surface of mature hematopoietic cells of the monocyte and myeloid lineages (at protein level). {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MWLLPALLLLCLSGCLSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGR VSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVN PGRNLSTGEVLTQNSGFRLSSPHFLLVVLLKLPLLLSMLGAVFWVNRPQWAPPGR | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CD300E  Malacards: CD300E | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||