• Gene id: 340371

Gene Summary

• Gene Symbol: NRBP2   Gene   UCSC   Ensembl
• Aliases: TRG16, pp9320
• Gene name: nuclear receptor binding protein 2
• Alternate names: nuclear receptor-binding protein 2, transformation-related protein 16,
• Gene location: 8q24.3 (143840973: 143829775)     Exons: 21     NC_000008.11
• OMIM: 616884

Protein Summary

• Protein general information: Q9NSY0  
  • Name: Nuclear receptor binding protein 2 (Transformation related gene 16 protein) (TRG 16)
  • Length: 501  
  • Mass: 57803
• Sequence:

  MAAPEPAPRRAREREREREDESEDESDILEESPCGRWQKRREQVNQGNMPGLQSTFLAMDTEEGVEVVWNELHFG
  DRKAFAAHEEKIQTVFEQLVLVDHPNIVKLHKYWLDTSEACARVIFITEYVSSGSLKQFLKKTKKNHKAMNARAW
  KRWCTQILSALSFLHACSPPIIHGNLTSDTIFIQHNGLIKIGSVWHRIFSNALPDDLRSPIRAEREELRNLHFFP
  PEYGEVADGTAVDIFSFGMCALEMAVLEIQTNGDTRVTEEAIARARHSLSDPNMREFILCCLARDPARRPSAHSL
  LFHRVLFEVHSLKLLAAHCFIQHQYLMPENVVEEKTKAMDLHAVLAELPRPRRPPLQWRYSEVSFMELDKFLEDV
  RNGIYPLMNFAATRPLGLPRVLAPPPEEVQKAKTPTPEPFDSETRKVIQMQCNLERSEDKARWHLTLLLVLEDRL
  HRQLTYDLLPTDSAQDLASELVHYGFLHEDDRMKLAAFLESTFLKYRGTQA

• Structural information:
  • Protein Domains: (38..30-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR042697  IPR000719  
  • Prosite: PS50011
  • CDD: cd14035
  • STRING: ENSP00000414055
• Other Databases: GeneCards:  NRBP2  Malacards:  NRBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0012505	endomembrane system	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0006468	protein phosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0016242	negative regulation of macroautophagy	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0030182	neuron differentiation	ISS	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray