• Gene id: 340205

Gene Summary

• Gene Symbol: TREML1   Gene   UCSC   Ensembl
• Aliases: GLTL1825, PRO3438, TLT-1, TLT1, dJ238O23.3
• Gene name: triggering receptor expressed on myeloid cells like 1
• Alternate names: trem-like transcript 1 protein, triggering receptor expressed on myeloid cells-like protein 1,
• Gene location: 6p21.1 (41158449: 41149096)     Exons: 9     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in
• OMIM: 609714

Protein Summary

• Protein general information: Q86YW5  
  • Name: Trem like transcript 1 protein (TLT 1) (Triggering receptor expressed on myeloid cells like protein 1)
  • Length: 311  
  • Mass: 32679
  • Tissue specificity: Detected in platelets, monocytic leukemia and in T-cell leukemia. {ECO
• Sequence:

  MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGR
  RTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSAN
  PLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVMAKRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAEL
  PLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPA
  QNPPNNQTPSS

• Structural information:
  • Protein Domains: (16..12-)
    (/note="Ig-like-V-type")
  • Interpro: IPR036179  IPR013783  
  • PDB: 2FRG
  • PDBsum: 2FRG
  • STRING: ENSP00000402855
• Other Databases: GeneCards:  TREML1  Malacards:  TREML1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030168	platelet activation	IEA	biological process
GO:0031091	platelet alpha granule	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0045087	innate immune response	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray