• Gene id: 340146

Gene Summary

• Gene Symbol: SLC35D3   Gene   UCSC   Ensembl
• Aliases: FRCL1
• Gene name: solute carrier family 35 member D3
• Alternate names: solute carrier family 35 member D3, frc, fringe-like 1, fringe connection-like protein 1,
• Gene location: 6q23.3 (136922300: 136925659)     Exons: 2     NC_000006.12
• OMIM: 611106

Protein Summary

• Protein general information: Q5M8T2  
  • Name: Solute carrier family 35 member D3 (Fringe connection like protein 1)
  • Length: 416  
  • Mass: 44183
• Sequence:

  MRQLCRGRVLGISVAIAHGVFSGSLNILLKFLISRYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLA
  RSFAGVAVLSTLQSSLTLWSLRGLSLPMYVVFKRCLPLVTMLIGVLVLKNGAPSPGVLAAVLITTCGAALAGAGD
  LTGDPIGYVTGVLAVLVHAAYLVLIQKASADTEHGPLTAQYVIAVSATPLLVICSFASTDSIHAWTFPGWKDPAM
  VCIFVACILIGCAMNFTTLHCTYINSAVTTSFVGVVKSIATITVGMVAFSDVEPTSLFIAGVVVNTLGSIIYCVA
  KFMETRKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAG
  SSEEGSRRSLKDAYLEVWRLVRGTRYMKKDYLIENEELPSP

• Structural information:
  • STRING: ENSP00000333591
• Other Databases: GeneCards:  SLC35D3  Malacards:  SLC35D3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0015297	antiporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0097009	energy homeostasis	IEA	biological process
GO:0070863	positive regulation of protein exit from endoplasmic reticulum	IEA	biological process
GO:0005769	early endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq