• Gene id: 339976

Gene Summary

• Gene Symbol: TRIML1   Gene   UCSC   Ensembl
• Aliases: RNF209
• Gene name: tripartite motif family like 1
• Alternate names: probable E3 ubiquitin-protein ligase TRIML1, RING finger protein 209, RING-type E3 ubiquitin transferase TRIML1,
• Gene location: 4q35.2 (188137228: 188150767)     Exons: 9     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a tripartite motif family protein with similarities to E3 ubiquitin-protein ligases. While the function of the encoded protein has not been determined, the orthologous protein in mouse has been shown to bind ubiquitin-s
• OMIM: 114085

Protein Summary

• Protein general information: Q8N9V2  
  • Name: Probable E3 ubiquitin protein ligase TRIML1 (EC 2.3.2.27) (RING finger protein 209) (RING type E3 ubiquitin transferase TRIML1) (Tripartite motif family like protein 1)
  • Length: 468  
  • Mass: 53002
• Sequence:

  MSTADLMENLREELTCFICLDYFSSPVTTECGHSFCLVCLLRSWEEHNTPLSCPECWRTLEGPHFQSNERLGRLA
  SIARQLRSQVLQSEDEQGSYGRMPTTAKALSDDEQGGSAFVAQSHGANRVHLSSEAEEHHREKLQEILNLLRVRR
  KEAQAVLTHEKERVKLCQEETKTCKQVVVSEYMKMHQFLKEEEQLQLQLLEQEEKENMRKLRNNEIKLTQQIRSL
  SKMIAQIESSSQSSAFESLEEVRGALERSEPLLLQCPEATTTELSLCRITGMKEMLRKFSTEITLDPATANAYLV
  LSEDLKSVKYGGSRQQLPDNPERFDQSATVLGTQIFTSGRHYWEVEVGNKTEWEVGICKDSVSRKGNLPKPPGDL
  FSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAFYNGTDESLIYSFPQASFQEALRPIFSPCLP
  NEGTNTDPLTICSLNSHV

• Structural information:
  • Protein Domains: (267..46-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR003877   IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS00518 PS50089
  • STRING: ENSP00000327738
• Other Databases: GeneCards:  TRIML1  Malacards:  TRIML1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0045087	innate immune response	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray